Lineage for d2euib_ (2eui B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2574995Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2575349Protein automated matches [190241] (13 species)
    not a true protein
  7. 2575418Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [187674] (2 PDB entries)
  8. 2575422Domain d2euib_: 2eui B: [132388]
    Other proteins in same PDB: d2euia1
    automated match to d2euia1

Details for d2euib_

PDB Entry: 2eui (more details), 2.8 Å

PDB Description: crystal structure of a probable acetyltransferase
PDB Compounds: (B:) Probable acetyltransferase

SCOPe Domain Sequences for d2euib_:

Sequence, based on SEQRES records: (download)

>d2euib_ d.108.1.1 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mrivqatlehldllaplfvkyrefygmlsypessrkflekrlrrkesviylaladeedrl
lgfcqlypsfsslslkrvwilndiyvaeearrqlvadhllqhakqmarethavrmrvsts
vdnevaqkvyesigfredqefknytlpisd

Sequence, based on observed residues (ATOM records): (download)

>d2euib_ d.108.1.1 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mrivqatlehldllaplfvkyrefygmlsypessrkflekrlrrkesviylaladrllgf
cqlypsfsslslkrvwilndiyvaeearrqlvadhllqhakqmarethavrmrvstsvne
vaqkvyesigfredqefknytlpisd

SCOPe Domain Coordinates for d2euib_:

Click to download the PDB-style file with coordinates for d2euib_.
(The format of our PDB-style files is described here.)

Timeline for d2euib_: