Lineage for d2euib1 (2eui B:1-150)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731217Protein Probable acetyltransferase PA4026 [143692] (1 species)
  7. 731218Species Pseudomonas aeruginosa [TaxId:287] [143693] (1 PDB entry)
  8. 731220Domain d2euib1: 2eui B:1-150 [132388]
    automatically matched to 2EUI A:1-153

Details for d2euib1

PDB Entry: 2eui (more details), 2.8 Å

PDB Description: crystal structure of a probable acetyltransferase
PDB Compounds: (B:) Probable acetyltransferase

SCOP Domain Sequences for d2euib1:

Sequence, based on SEQRES records: (download)

>d2euib1 d.108.1.1 (B:1-150) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]}
mrivqatlehldllaplfvkyrefygmlsypessrkflekrlrrkesviylaladeedrl
lgfcqlypsfsslslkrvwilndiyvaeearrqlvadhllqhakqmarethavrmrvsts
vdnevaqkvyesigfredqefknytlpisd

Sequence, based on observed residues (ATOM records): (download)

>d2euib1 d.108.1.1 (B:1-150) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]}
mrivqatlehldllaplfvkyrefygmlsypessrkflekrlrrkesviylaladrllgf
cqlypsfsslslkrvwilndiyvaeearrqlvadhllqhakqmarethavrmrvstsvne
vaqkvyesigfredqefknytlpisd

SCOP Domain Coordinates for d2euib1:

Click to download the PDB-style file with coordinates for d2euib1.
(The format of our PDB-style files is described here.)

Timeline for d2euib1: