![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.249: YfmB-like [140687] (1 superfamily) 5 helices, array; buried N-terminal helix; some topological similarity (circular permutation?) to the Nucleotidyltransferase substrate binding subunit/domain (81593) |
![]() | Superfamily a.249.1: YfmB-like [140688] (1 family) ![]() automatically mapped to Pfam PF11486 |
![]() | Family a.249.1.1: YfmB-like [140689] (1 protein) |
![]() | Protein Hypothetical protein YfmB [140690] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [140691] (1 PDB entry) Uniprot O34626 1-113 |
![]() | Domain d2eucb_: 2euc B: [132383] automated match to d2euca1 |
PDB Entry: 2euc (more details), 2.5 Å
SCOPe Domain Sequences for d2eucb_:
Sequence, based on SEQRES records: (download)
>d2eucb_ a.249.1.1 (B:) Hypothetical protein YfmB {Bacillus subtilis [TaxId: 1423]} mqyfspeqqynawivsdlvkqifhkragcspgihelavfaeehfhididfvfsiimnigd iefaltdeiekklsgylstllpyvtadmfetskanahaflsrrhgnaayhlfv
>d2eucb_ a.249.1.1 (B:) Hypothetical protein YfmB {Bacillus subtilis [TaxId: 1423]} mqyfspeqqynawivsdlvkqifhkragcspgihelavfaeehfhididfvfsiimnigd iefaltdeiekklsgylstllpyvtadmfetskanahaflsaayhlfv
Timeline for d2eucb_: