Lineage for d2eucb_ (2euc B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016059Fold a.249: YfmB-like [140687] (1 superfamily)
    5 helices, array; buried N-terminal helix; some topological similarity (circular permutation?) to the Nucleotidyltransferase substrate binding subunit/domain (81593)
  4. 2016060Superfamily a.249.1: YfmB-like [140688] (1 family) (S)
    automatically mapped to Pfam PF11486
  5. 2016061Family a.249.1.1: YfmB-like [140689] (1 protein)
  6. 2016062Protein Hypothetical protein YfmB [140690] (1 species)
  7. 2016063Species Bacillus subtilis [TaxId:1423] [140691] (1 PDB entry)
    Uniprot O34626 1-113
  8. 2016065Domain d2eucb_: 2euc B: [132383]
    automated match to d2euca1

Details for d2eucb_

PDB Entry: 2euc (more details), 2.5 Å

PDB Description: crystal structure of yfmb from bacillus subtilis. nesg target sr324
PDB Compounds: (B:) Hypothetical protein yfmB

SCOPe Domain Sequences for d2eucb_:

Sequence, based on SEQRES records: (download)

>d2eucb_ a.249.1.1 (B:) Hypothetical protein YfmB {Bacillus subtilis [TaxId: 1423]}
mqyfspeqqynawivsdlvkqifhkragcspgihelavfaeehfhididfvfsiimnigd
iefaltdeiekklsgylstllpyvtadmfetskanahaflsrrhgnaayhlfv

Sequence, based on observed residues (ATOM records): (download)

>d2eucb_ a.249.1.1 (B:) Hypothetical protein YfmB {Bacillus subtilis [TaxId: 1423]}
mqyfspeqqynawivsdlvkqifhkragcspgihelavfaeehfhididfvfsiimnigd
iefaltdeiekklsgylstllpyvtadmfetskanahaflsaayhlfv

SCOPe Domain Coordinates for d2eucb_:

Click to download the PDB-style file with coordinates for d2eucb_.
(The format of our PDB-style files is described here.)

Timeline for d2eucb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2euca1