SCOPe 2.08: Domain d2eucb_: 2euc B:

Lineage for d2eucb_ (2euc B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.249: YfmB-like [140687] (1 superfamily)
   5 helices, array; buried N-terminal helix; some topological similarity (circular permutation?) to the Nucleotidyltransferase substrate binding subunit/domain (81593)

4. Superfamily a.249.1: YfmB-like [140688] (1 family)
   automatically mapped to Pfam PF11486

5. Family a.249.1.1: YfmB-like [140689] (1 protein)

6. Protein Hypothetical protein YfmB [140690] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [140691] (1 PDB entry)
   Uniprot O34626 1-113

8. Domain d2eucb_: 2euc B: [132383]
   automated match to d2euca1

Details for d2eucb_

PDB Entry: 2euc, 2.5 Å

PDB Description: crystal structure of yfmb from bacillus subtilis. nesg target sr324

PDB Compounds: (B:) Hypothetical protein yfmB

SCOPe Domain Sequences for d2eucb_:

Sequence, based on SEQRES records:

>d2eucb_ a.249.1.1 (B:) Hypothetical protein YfmB {Bacillus subtilis [TaxId: 1423]}
mqyfspeqqynawivsdlvkqifhkragcspgihelavfaeehfhididfvfsiimnigd
iefaltdeiekklsgylstllpyvtadmfetskanahaflsrrhgnaayhlfv

Sequence, based on observed residues (ATOM records):

>d2eucb_ a.249.1.1 (B:) Hypothetical protein YfmB {Bacillus subtilis [TaxId: 1423]}
mqyfspeqqynawivsdlvkqifhkragcspgihelavfaeehfhididfvfsiimnigd
iefaltdeiekklsgylstllpyvtadmfetskanahaflsaayhlfv

Timeline for d2eucb_:

• d2eucb_ first appeared in SCOP 1.73, called d2eucb1
  
• d2eucb_ appears in SCOPe 2.07