SCOPe 2.08: Domain d2euca1: 2euc A:1-113

Lineage for d2euca1 (2euc A:1-113)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.249: YfmB-like [140687] (1 superfamily)
   5 helices, array; buried N-terminal helix; some topological similarity (circular permutation?) to the Nucleotidyltransferase substrate binding subunit/domain (81593)

4. Superfamily a.249.1: YfmB-like [140688] (1 family)
   automatically mapped to Pfam PF11486

5. Family a.249.1.1: YfmB-like [140689] (1 protein)

6. Protein Hypothetical protein YfmB [140690] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [140691] (1 PDB entry)
   Uniprot O34626 1-113

8. Domain d2euca1: 2euc A:1-113 [132382]

Details for d2euca1

PDB Entry: 2euc, 2.5 Å

PDB Description: crystal structure of yfmb from bacillus subtilis. nesg target sr324

PDB Compounds: (A:) Hypothetical protein yfmB

SCOPe Domain Sequences for d2euca1:

Sequence, based on SEQRES records:

>d2euca1 a.249.1.1 (A:1-113) Hypothetical protein YfmB {Bacillus subtilis [TaxId: 1423]}
mqyfspeqqynawivsdlvkqifhkragcspgihelavfaeehfhididfvfsiimnigd
iefaltdeiekklsgylstllpyvtadmfetskanahaflsrrhgnaayhlfv

Sequence, based on observed residues (ATOM records):

>d2euca1 a.249.1.1 (A:1-113) Hypothetical protein YfmB {Bacillus subtilis [TaxId: 1423]}
mqyfspeqqynawivsdlvkqifhkragcspgihelavfaeehfhididfvfsiimnigd
iefaltdeiekklsgylstllpyvtadmfetskanahaflsaayhlfv

Timeline for d2euca1:

• d2euca1 first appeared in SCOP 1.73
  
• d2euca1 appears in SCOPe 2.07