Lineage for d2esla1 (2esl A:32-212)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1134137Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1134138Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1134139Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
  6. 1134140Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 1134267Species Human (Homo sapiens), variant C [TaxId:9606] [141498] (1 PDB entry)
    Uniprot P45877 32-212
  8. 1134268Domain d2esla1: 2esl A:32-212 [132327]
    complexed with ca, so4, zn

Details for d2esla1

PDB Entry: 2esl (more details), 1.9 Å

PDB Description: human cyclophilin c in complex with cyclosporin a
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase c

SCOPe Domain Sequences for d2esla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2esla1 b.62.1.1 (A:32-212) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant C [TaxId: 9606]}
rgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygykgskfhrvi
kdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtngsqffitlt
kptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvktpfvveiad
w

SCOPe Domain Coordinates for d2esla1:

Click to download the PDB-style file with coordinates for d2esla1.
(The format of our PDB-style files is described here.)

Timeline for d2esla1: