![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
![]() | Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
![]() | Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
![]() | Protein Cyclophilin (eukaryotic) [50893] (13 species) |
![]() | Species Human (Homo sapiens), variant C [TaxId:9606] [141498] (1 PDB entry) Uniprot P45877 32-212 |
![]() | Domain d2esla1: 2esl A:32-212 [132327] complexed with ca, so4, zn |
PDB Entry: 2esl (more details), 1.9 Å
SCOPe Domain Sequences for d2esla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2esla1 b.62.1.1 (A:32-212) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant C [TaxId: 9606]} rgpsvtakvffdvrigdkdvgriviglfgkvvpktvenfvalatgekgygykgskfhrvi kdfmiqggdittgdgtggvsiygetfpdenfklkhygigwvsmanagpdtngsqffitlt kptwldgkhvvfgkvidgmtvvhsielqatdghdrpltncsiinsgkidvktpfvveiad w
Timeline for d2esla1: