SCOPe 2.08: Domain d2ekec2: 2eke C:1013-1095

Lineage for d2ekec2 (2eke C:1013-1095)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein SUMO-1 (smt3 homologue) [54241] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [54243] (3 PDB entries)

8. Domain d2ekec2: 2eke C:1013-1095 [132283]
   Other proteins in same PDB: d2ekea_, d2ekeb_, d2ekec3, d2eked3
   automated match to d1a5ra_

Details for d2ekec2

PDB Entry: 2eke, 1.9 Å

PDB Description: Structure of a SUMO-binding-motif mimic bound to Smt3p-Ubc9p: conservation of a noncovalent Ubiquitin-like protein-E2 complex as a platform for selective interactions within a SUMO pathway

PDB Compounds: (C:) Ubiquitin-like protein SMT3

SCOPe Domain Sequences for d2ekec2:

Sequence; same for both SEQRES and ATOM records:

>d2ekec2 d.15.1.1 (C:1013-1095) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
evkpevkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiri
qadqtpedldmedndiieahreq

Timeline for d2ekec2:

• d2ekec2 first appeared in SCOP 1.73, called d2ekec1
  
• d2ekec2 appears in SCOPe 2.07