![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (7 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
![]() | Protein SUMO-1 (smt3 homologue) [54241] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [54243] (3 PDB entries) |
![]() | Domain d2ekec1: 2eke C:1020-1095 [132283] automatically matched to d1euvb_ mutant |
PDB Entry: 2eke (more details), 1.9 Å
SCOP Domain Sequences for d2ekec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ekec1 d.15.1.1 (C:1020-1095) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} pethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpe dldmedndiieahreq
Timeline for d2ekec1: