SCOP 1.73: Domain d2ekec1: 2eke C:1020-1095

Lineage for d2ekec1 (2eke C:1020-1095)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (7 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
   Pfam PF00240

6. Protein SUMO-1 (smt3 homologue) [54241] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [54243] (3 PDB entries)

8. Domain d2ekec1: 2eke C:1020-1095 [132283]
   automatically matched to d1euvb_
   mutant

Details for d2ekec1

PDB Entry: 2eke, 1.9 Å

PDB Description: Structure of a SUMO-binding-motif mimic bound to Smt3p-Ubc9p: conservation of a noncovalent Ubiquitin-like protein-E2 complex as a platform for selective interactions within a SUMO pathway

PDB Compounds: (C:) Ubiquitin-like protein SMT3

SCOP Domain Sequences for d2ekec1:

Sequence; same for both SEQRES and ATOM records:

>d2ekec1 d.15.1.1 (C:1020-1095) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
pethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpe
dldmedndiieahreq

Timeline for d2ekec1:

• d2ekec1 is new in SCOP 1.73
  
• d2ekec1 appears in SCOP 1.75
  
• d2ekec1 appears in the current release, SCOPe 2.08, called d2ekec2