Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.7: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81431] (1 family) |
Family f.23.7.1: Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81430] (1 protein) |
Protein Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) [81429] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
Species Cow (Bos taurus) [TaxId:9913] [81428] (14 PDB entries) |
Domain d2eilz1: 2eil Z:1-43 [132222] Other proteins in same PDB: d2eila1, d2eilb1, d2eilb2, d2eilc1, d2eild1, d2eile1, d2eilf1, d2eilg1, d2eilh1, d2eili1, d2eilj1, d2eilk1, d2eill1, d2eiln1, d2eilo1, d2eilo2, d2eilp1, d2eilq1, d2eilr1, d2eils1, d2eilt1, d2eilu1, d2eilv1, d2eilw1, d2eilx1, d2eily1 automatically matched to d1occm_ complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eil (more details), 2.1 Å
SCOP Domain Sequences for d2eilz1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eilz1 f.23.7.1 (Z:1-43) Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX) {Cow (Bos taurus) [TaxId: 9913]} itakpaktptspkeqaiglsvtflsfllpagwvlyhldnykks
Timeline for d2eilz1:
View in 3D Domains from other chains: (mouse over for more information) d2eila1, d2eilb1, d2eilb2, d2eilc1, d2eild1, d2eile1, d2eilf1, d2eilg1, d2eilh1, d2eili1, d2eilj1, d2eilk1, d2eill1, d2eilm1, d2eiln1, d2eilo1, d2eilo2, d2eilp1, d2eilq1, d2eilr1, d2eils1, d2eilt1, d2eilu1, d2eilv1, d2eilw1, d2eilx1, d2eily1 |