SCOP 1.75: Domain d2eilb1: 2eil B:91-227

Lineage for d2eilb1 (2eil B:91-227)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49545] (14 PDB entries)

8. Domain d2eilb1: 2eil B:91-227 [132196]
   Other proteins in same PDB: d2eila1, d2eilb2, d2eilc1, d2eild1, d2eile1, d2eilf1, d2eilg1, d2eilh1, d2eili1, d2eilj1, d2eilk1, d2eill1, d2eilm1, d2eiln1, d2eilo2, d2eilp1, d2eilq1, d2eilr1, d2eils1, d2eilt1, d2eilu1, d2eilv1, d2eilw1, d2eilx1, d2eily1, d2eilz1
   automatically matched to d1occb1
   complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eilb1

PDB Entry: 2eil, 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d2eilb1:

Sequence; same for both SEQRES and ATOM records:

>d2eilb1 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

Timeline for d2eilb1:

• d2eilb1 first appeared in SCOP 1.73
  
• d2eilb1 appears in SCOPe 2.01
  
• d2eilb1 appears in the current release, SCOPe 2.08