SCOP 1.75: Domain d2eild1: 2eil D:4-147

Lineage for d2eild1 (2eil D:4-147)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family)

5. Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81403] (14 PDB entries)

8. Domain d2eild1: 2eil D:4-147 [132199]
   Other proteins in same PDB: d2eila1, d2eilb1, d2eilb2, d2eilc1, d2eile1, d2eilf1, d2eilg1, d2eilh1, d2eili1, d2eilj1, d2eilk1, d2eill1, d2eilm1, d2eiln1, d2eilo1, d2eilo2, d2eilp1, d2eilr1, d2eils1, d2eilt1, d2eilu1, d2eilv1, d2eilw1, d2eilx1, d2eily1, d2eilz1
   automatically matched to d1occd_
   complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eild1

PDB Entry: 2eil, 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state

PDB Compounds: (D:) Cytochrome c oxidase subunit 4 isoform 1

SCOP Domain Sequences for d2eild1:

Sequence; same for both SEQRES and ATOM records:

>d2eild1 f.23.1.1 (D:4-147) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

Timeline for d2eild1:

• d2eild1 first appeared in SCOP 1.73
  
• d2eild1 is called d2eild_ in SCOPe 2.01
  
• d2eild1 appears in the current release, SCOPe 2.08, called d2eild_