Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) |
Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (1 protein) |
Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
Species Cow (Bos taurus) [TaxId:9913] [81403] (14 PDB entries) |
Domain d2eild1: 2eil D:4-147 [132199] Other proteins in same PDB: d2eila1, d2eilb1, d2eilb2, d2eilc1, d2eile1, d2eilf1, d2eilg1, d2eilh1, d2eili1, d2eilj1, d2eilk1, d2eill1, d2eilm1, d2eiln1, d2eilo1, d2eilo2, d2eilp1, d2eilr1, d2eils1, d2eilt1, d2eilu1, d2eilv1, d2eilw1, d2eilx1, d2eily1, d2eilz1 automatically matched to d1occd_ complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 2eil (more details), 2.1 Å
SCOP Domain Sequences for d2eild1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eild1 f.23.1.1 (D:4-147) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]} svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm ldmkvapiqgfsakwdydknewkk
Timeline for d2eild1:
View in 3D Domains from other chains: (mouse over for more information) d2eila1, d2eilb1, d2eilb2, d2eilc1, d2eile1, d2eilf1, d2eilg1, d2eilh1, d2eili1, d2eilj1, d2eilk1, d2eill1, d2eilm1, d2eiln1, d2eilo1, d2eilo2, d2eilp1, d2eilq1, d2eilr1, d2eils1, d2eilt1, d2eilu1, d2eilv1, d2eilw1, d2eilx1, d2eily1, d2eilz1 |