SCOPe 2.08: Domain d2eiky_: 2eik Y:

Lineage for d2eiky_ (2eik Y:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family)
   automatically mapped to Pfam PF02935

5. Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81424] (50 PDB entries)

8. Domain d2eiky_: 2eik Y: [132193]
   Other proteins in same PDB: d2eika_, d2eikb1, d2eikb2, d2eikc_, d2eikd_, d2eike_, d2eikf_, d2eikg_, d2eikh_, d2eiki_, d2eikj_, d2eikk_, d2eikm_, d2eikn_, d2eiko1, d2eiko2, d2eikp_, d2eikq_, d2eikr_, d2eiks_, d2eikt_, d2eiku_, d2eikv_, d2eikw_, d2eikx_, d2eikz_
   automated match to d1occl_
   complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eiky_

PDB Entry: 2eik, 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state

PDB Compounds: (Y:) Cytochrome c oxidase polypeptide VIIc

SCOPe Domain Sequences for d2eiky_:

Sequence; same for both SEQRES and ATOM records:

>d2eiky_ f.23.6.1 (Y:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

Timeline for d2eiky_:

• d2eiky_ first appeared in SCOP 1.73, called d2eiky1
  
• d2eiky_ appears in SCOPe 2.07