Lineage for d2eikw1 (2eik W:1-58)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745630Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) (S)
  5. 745631Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (1 protein)
  6. 745632Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 745633Species Cow (Bos taurus) [TaxId:9913] [81416] (14 PDB entries)
  8. 745645Domain d2eikw1: 2eik W:1-58 [132191]
    Other proteins in same PDB: d2eika1, d2eikb1, d2eikb2, d2eikc1, d2eikd1, d2eike1, d2eikf1, d2eikg1, d2eikh1, d2eiki1, d2eikk1, d2eikl1, d2eikm1, d2eikn1, d2eiko1, d2eiko2, d2eikp1, d2eikq1, d2eikr1, d2eiks1, d2eikt1, d2eiku1, d2eikv1, d2eikx1, d2eiky1, d2eikz1
    automatically matched to d1ocrj_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eikw1

PDB Entry: 2eik (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (W:) Cytochrome c oxidase polypeptide VIIa-heart

SCOP Domain Sequences for d2eikw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eikw1 f.23.4.1 (W:1-58) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]}
fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk

SCOP Domain Coordinates for d2eikw1:

Click to download the PDB-style file with coordinates for d2eikw1.
(The format of our PDB-style files is described here.)

Timeline for d2eikw1: