Lineage for d2eikc1 (2eik C:3-261)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746159Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 746160Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
  5. 746161Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 746174Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 746175Species Cow (Bos taurus) [TaxId:9913] [81444] (14 PDB entries)
  8. 746186Domain d2eikc1: 2eik C:3-261 [132170]
    Other proteins in same PDB: d2eika1, d2eikb1, d2eikb2, d2eikd1, d2eike1, d2eikf1, d2eikg1, d2eikh1, d2eiki1, d2eikj1, d2eikk1, d2eikl1, d2eikm1, d2eikn1, d2eiko1, d2eiko2, d2eikq1, d2eikr1, d2eiks1, d2eikt1, d2eiku1, d2eikv1, d2eikw1, d2eikx1, d2eiky1, d2eikz1
    automatically matched to d1v54c_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eikc1

PDB Entry: 2eik (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOP Domain Sequences for d2eikc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eikc1 f.25.1.1 (C:3-261) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOP Domain Coordinates for d2eikc1:

Click to download the PDB-style file with coordinates for d2eikc1.
(The format of our PDB-style files is described here.)

Timeline for d2eikc1: