Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) |
Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins) |
Protein PetM subunit of the cytochrome b6f complex [103443] (2 species) |
Species Mastigocladus laminosus [TaxId:83541] [103444] (8 PDB entries) |
Domain d2e76f1: 2e76 F:1-32 [132061] Other proteins in same PDB: d2e76a1, d2e76b1, d2e76d1, d2e76d2, d2e76e1, d2e76g1, d2e76h1 automatically matched to d1vf5s_ complexed with bcr, cd, cla, fes, hem, opc, sqd, tds, umq |
PDB Entry: 2e76 (more details), 3.41 Å
SCOPe Domain Sequences for d2e76f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e76f1 f.23.25.1 (F:1-32) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]} mteemlyaallsfglifvgwglgvlllkiqga
Timeline for d2e76f1: