SCOPe 2.04: Domain d2e5le1: 2e5l E:74-154

Lineage for d2e5le1 (2e5l E:74-154)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries)
   Uniprot P27152 ! Uniprot P80373

8. Domain d2e5le1: 2e5l E:74-154 [132028]
   Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1
   automatically matched to d1i94e1
   complexed with zn

Details for d2e5le1

PDB Entry: 2e5l, 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2e5le1:

Sequence; same for both SEQRES and ATOM records:

>d2e5le1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg

Timeline for d2e5le1:

• d2e5le1 first appeared in SCOP 1.73
  
• d2e5le1 appears in SCOPe 2.03
  
• d2e5le1 appears in SCOPe 2.05
  
• d2e5le1 appears in the current release, SCOPe 2.08