| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) ![]() |
| Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
| Protein Ribosomal protein S5, C-terminal domain [54215] (2 species) |
| Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries) |
| Domain d2e5le1: 2e5l E:74-154 [132028] Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lo1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1 automatically matched to d1i94e1 complexed with zn |
PDB Entry: 2e5l (more details), 3.3 Å
SCOP Domain Sequences for d2e5le1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e5le1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay
atmealrqlrtkadverlrkg
Timeline for d2e5le1: