| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) ![]() form homo and heterodimers |
| Family d.74.3.2: RBP11/RpoL [64311] (3 proteins) |
| Protein RPB11 [64312] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries) Uniprot P38902; part of multichain biological unit |
| Domain d2e2ik1: 2e2i K:1-114 [132005] Other proteins in same PDB: d2e2ia1, d2e2ib1, d2e2ic1, d2e2ic2, d2e2ie1, d2e2ie2, d2e2if1, d2e2ih1, d2e2ii1, d2e2ii2, d2e2ij1, d2e2il1 automatically matched to d1i3qk_ protein/DNA complex; protein/RNA complex; complexed with dgt, mg, zn |
PDB Entry: 2e2i (more details), 3.41 Å
SCOPe Domain Sequences for d2e2ik1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e2ik1 d.74.3.2 (K:1-114) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
Timeline for d2e2ik1: