SCOPe 2.01: Domain d2e2ih1: 2e2i H:2-146

Lineage for d2e2ih1 (2e2i H:2-146)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)
Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
Protein RNA polymerase subunit RBP8 [50322] (1 species)
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (30 PDB entries)
Uniprot P20436

Domain d2e2ih1: 2e2i H:2-146 [132001]
Other proteins in same PDB: d2e2ia1, d2e2ib1, d2e2ic1, d2e2ic2, d2e2ie1, d2e2ie2, d2e2if1, d2e2ii1, d2e2ii2, d2e2ij1, d2e2ik1, d2e2il1
automatically matched to d1a1d__
protein/DNA complex; protein/RNA complex; complexed with dgt, mg, zn

Details for d2e2ih1

PDB Entry: 2e2i (more details), 3.41 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dGTP

PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide

SCOPe Domain Sequences for d2e2ih1:

Sequence, based on SEQRES records: (download)

>d2e2ih1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d2e2ih1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr

SCOPe Domain Coordinates for d2e2ih1:

Click to download the PDB-style file with coordinates for d2e2ih1.
(The format of our PDB-style files is described here.)

Timeline for d2e2ih1: