SCOPe 2.04: Domain d2e1ra1: 2e1r A:344-481

Lineage for d2e1ra1 (2e1r A:344-481)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.0: automated matches [227211] (1 protein)
   not a true family

6. Protein automated matches [226946] (16 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255011] (4 PDB entries)

8. Domain d2e1ra1: 2e1r A:344-481 [131966]
   Other proteins in same PDB: d2e1ra2, d2e1ra3, d2e1ra4, d2e1ra5
   automated match to d1n0ua1
   complexed with gdp, sod

Details for d2e1ra1

PDB Entry: 2e1r, 3.15 Å

PDB Description: structure of eef2 in complex with a sordarin derivative

PDB Compounds: (A:) Elongation factor 2

SCOPe Domain Sequences for d2e1ra1:

Sequence; same for both SEQRES and ATOM records:

>d2e1ra1 b.43.3.0 (A:344-481) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

Timeline for d2e1ra1:

• d2e1ra1 first appeared in SCOP 1.73
  
• d2e1ra1 appears in SCOPe 2.03
  
• d2e1ra1 appears in SCOPe 2.05
  
• d2e1ra1 appears in the current release, SCOPe 2.08