Lineage for d2dysp1 (2dys P:3-261)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887842Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 887843Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
  5. 887844Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 887857Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 887858Species Cow (Bos taurus) [TaxId:9913] [81444] (14 PDB entries)
  8. 887872Domain d2dysp1: 2dys P:3-261 [131944]
    Other proteins in same PDB: d2dysa1, d2dysb1, d2dysb2, d2dysd1, d2dyse1, d2dysf1, d2dysg1, d2dysh1, d2dysi1, d2dysj1, d2dysk1, d2dysl1, d2dysm1, d2dysn1, d2dyso1, d2dyso2, d2dysq1, d2dysr1, d2dyss1, d2dyst1, d2dysu1, d2dysv1, d2dysw1, d2dysx1, d2dysy1, d2dysz1
    automatically matched to d1v54c_
    complexed with cdl, chd, cu, cua, dmu, glh, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dysp1

PDB Entry: 2dys (more details), 2.2 Å

PDB Description: Bovine heart cytochrome C oxidase modified by DCCD
PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOP Domain Sequences for d2dysp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dysp1 f.25.1.1 (P:3-261) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisqvlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOP Domain Coordinates for d2dysp1:

Click to download the PDB-style file with coordinates for d2dysp1.
(The format of our PDB-style files is described here.)

Timeline for d2dysp1: