Lineage for d2dyso1 (2dys O:91-227)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791487Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 791488Protein Cytochrome c oxidase [49544] (4 species)
  7. 791489Species Cow (Bos taurus) [TaxId:9913] [49545] (14 PDB entries)
  8. 791503Domain d2dyso1: 2dys O:91-227 [131942]
    Other proteins in same PDB: d2dysa1, d2dysb2, d2dysc1, d2dysd1, d2dyse1, d2dysf1, d2dysg1, d2dysh1, d2dysi1, d2dysj1, d2dysk1, d2dysl1, d2dysm1, d2dysn1, d2dyso2, d2dysp1, d2dysq1, d2dysr1, d2dyss1, d2dyst1, d2dysu1, d2dysv1, d2dysw1, d2dysx1, d2dysy1, d2dysz1
    automatically matched to d1occb1
    complexed with cdl, chd, cu, cua, dmu, glh, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyso1

PDB Entry: 2dys (more details), 2.2 Å

PDB Description: Bovine heart cytochrome C oxidase modified by DCCD
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d2dyso1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyso1 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOP Domain Coordinates for d2dyso1:

Click to download the PDB-style file with coordinates for d2dyso1.
(The format of our PDB-style files is described here.)

Timeline for d2dyso1: