Lineage for d2dyso2 (2dys O:1-90)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886795Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 886817Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 886818Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 886844Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 886845Species Cow (Bos taurus) [TaxId:9913] [81454] (14 PDB entries)
  8. 886859Domain d2dyso2: 2dys O:1-90 [131943]
    Other proteins in same PDB: d2dysa1, d2dysb1, d2dysc1, d2dysd1, d2dyse1, d2dysf1, d2dysg1, d2dysh1, d2dysi1, d2dysj1, d2dysk1, d2dysl1, d2dysm1, d2dysn1, d2dyso1, d2dysp1, d2dysq1, d2dysr1, d2dyss1, d2dyst1, d2dysu1, d2dysv1, d2dysw1, d2dysx1, d2dysy1, d2dysz1
    automatically matched to d1occb2
    complexed with cdl, chd, cu, cua, dmu, glh, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dyso2

PDB Entry: 2dys (more details), 2.2 Å

PDB Description: Bovine heart cytochrome C oxidase modified by DCCD
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOP Domain Sequences for d2dyso2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyso2 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOP Domain Coordinates for d2dyso2:

Click to download the PDB-style file with coordinates for d2dyso2.
(The format of our PDB-style files is described here.)

Timeline for d2dyso2: