Lineage for d2dy9b1 (2dy9 B:6-158)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861820Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 861821Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 861822Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 861843Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries)
    Uniprot O58429 3-155
  8. 861855Domain d2dy9b1: 2dy9 B:6-158 [131894]
    automatically matched to 2CWK A:6-158
    complexed with adp, cl, mg

Details for d2dy9b1

PDB Entry: 2dy9 (more details), 2.01 Å

PDB Description: Crystal structure of nucleoside diphosphate kinase in complex with ADP
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOP Domain Sequences for d2dy9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dy9b1 d.58.6.1 (B:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk
alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha
sdskesaereislffkpeelfeypraadwfykk

SCOP Domain Coordinates for d2dy9b1:

Click to download the PDB-style file with coordinates for d2dy9b1.
(The format of our PDB-style files is described here.)

Timeline for d2dy9b1: