Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein) |
Protein Nucleoside diphosphate kinase, NDK [54921] (20 species) |
Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries) Uniprot O58429 3-155 |
Domain d2dy9b1: 2dy9 B:6-158 [131894] automatically matched to 2CWK A:6-158 complexed with adp, cl, mg |
PDB Entry: 2dy9 (more details), 2.01 Å
SCOP Domain Sequences for d2dy9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dy9b1 d.58.6.1 (B:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha sdskesaereislffkpeelfeypraadwfykk
Timeline for d2dy9b1: