SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2dy9b_ (2dy9 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2173863Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2173864Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 2173865Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)
  7. 2174020Species Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries)
    Uniprot O58429 3-155
  8. 2174031Domain d2dy9b_: 2dy9 B: [131894]
    automated match to d2cwka1
    complexed with adp, cl, mg

Details for d2dy9b_

PDB Entry: 2dy9 (more details), 2.01 Å

PDB Description: Crystal structure of nucleoside diphosphate kinase in complex with ADP
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2dy9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dy9b_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Pyrococcus horikoshii [TaxId: 53953]}
setertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpff
kalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnvih
asdskesaereislffkpeelfeypraadwfykkgi

SCOPe Domain Coordinates for d2dy9b_:

Click to download the PDB-style file with coordinates for d2dy9b_.
(The format of our PDB-style files is described here.)

Timeline for d2dy9b_: