SCOPe 2.08: Domain d2dvxa_: 2dvx A:

Lineage for d2dvxa_ (2dvx A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins)
   Pfam PF04909; Amidohydrolase; stand-alone domain

6. Protein Thermophilic reversible gamma-resorcylate decarboxylase [141822] (1 species)

7. Species Rhizobium sp. MTP-10005 [TaxId:267998] [141823] (3 PDB entries)
   Uniprot Q60GU1 1-325

8. Domain d2dvxa_: 2dvx A: [131801]
   automated match to d2dvta1
   complexed with 23a, zn

Details for d2dvxa_

PDB Entry: 2dvx, 1.7 Å

PDB Description: Crystal Structure of 2,6-Dihydroxybenzoate Decarboxylase Complexed with inhibitor 2,3-dihydroxybenzaldehyde

PDB Compounds: (A:) Thermophilic reversible gamma-resorcylate decarboxylase

SCOPe Domain Sequences for d2dvxa_:

Sequence; same for both SEQRES and ATOM records:

>d2dvxa_ c.1.9.15 (A:) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]}
mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln
apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl
gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp
wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp
prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf
natsiaeadrvkigrtnarrlfkld

Timeline for d2dvxa_:

• d2dvxa_ first appeared in SCOP 1.73, called d2dvxa1
  
• d2dvxa_ appears in SCOPe 2.07