Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins) Pfam PF04909; Amidohydrolase; stand-alone domain |
Protein Thermophilic reversible gamma-resorcylate decarboxylase [141822] (1 species) |
Species Rhizobium sp. MTP-10005 [TaxId:267998] [141823] (3 PDB entries) Uniprot Q60GU1 1-325 |
Domain d2dvxb_: 2dvx B: [131802] automated match to d2dvta1 complexed with 23a, zn |
PDB Entry: 2dvx (more details), 1.7 Å
SCOPe Domain Sequences for d2dvxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dvxb_ c.1.9.15 (B:) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]} mqgkvaleehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklmdahgietmilsln apavqaipdrrkaieiarrandvlaeecakrpdrflafaalplqdpdaateelqrcvndl gfvgalvngfsqegdgqtplyydlpqyrpfwgevekldvpfylhprnplpqdsriydghp wllgptwafaqetavhalrlmasglfdehprlniilghmgeglpymmwridhrnawvklp prypakrrfmdyfnenfhittsgnfrtqtlidaileigadrilfstdwpfenidhasdwf natsiaeadrvkigrtnarrlfkl
Timeline for d2dvxb_: