SCOPe 2.06: Domain d2dvbb_: 2dvb B:

Lineage for d2dvbb_ (2dvb B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (24 PDB entries)
   Uniprot P02872 24-255

8. Domain d2dvbb_: 2dvb B: [131774]
   automated match to d1bzwa_
   complexed with ca, gal, mn, so4

Details for d2dvbb_

PDB Entry: 2dvb, 2.25 Å

PDB Description: crystal structure of peanut lectin gal-beta-1,6-galnac complex

PDB Compounds: (B:) Galactose-binding lectin

SCOPe Domain Sequences for d2dvbb_:

Sequence; same for both SEQRES and ATOM records:

>d2dvbb_ b.29.1.1 (B:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

Timeline for d2dvbb_:

• d2dvbb_ first appeared in SCOP 1.73, called d2dvbb1
  
• d2dvbb_ appears in SCOPe 2.05
  
• d2dvbb_ appears in SCOPe 2.07
  
• d2dvbb_ appears in the current release, SCOPe 2.08