Lineage for d2dv8a1 (2dv8 A:1-133)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649171Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 649172Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 649177Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 649265Protein Snake phospholipase A2 [48624] (35 species)
  7. 649425Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (47 PDB entries)
  8. 649440Domain d2dv8a1: 2dv8 A:1-133 [131764]
    automatically matched to d1cl5a_
    complexed with imn, so4

Details for d2dv8a1

PDB Entry: 2dv8 (more details), 1.4 Å

PDB Description: Crystal structure of Phospholipase A2 complex with Indomethacin at 1.4 A resolution reveals a novel non-competitive ligand binding site
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOP Domain Sequences for d2dv8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dv8a1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOP Domain Coordinates for d2dv8a1:

Click to download the PDB-style file with coordinates for d2dv8a1.
(The format of our PDB-style files is described here.)

Timeline for d2dv8a1: