SCOPe 2.08: Domain d2dsoe2: 2dso E:6-325

Lineage for d2dsoe2 (2dso E:6-325)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families)

5. Family b.68.6.1: SGL-like [63830] (4 proteins)

6. Protein automated matches [190602] (2 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [187620] (3 PDB entries)

8. Domain d2dsoe2: 2dso E:6-325 [131693]
   Other proteins in same PDB: d2dsoa1, d2dsoa2, d2dsob3, d2dsoc3, d2dsoe3, d2dsof3
   automated match to d2dg0a1
   complexed with ca, gol; mutant

Details for d2dsoe2

PDB Entry: 2dso, 2.1 Å

PDB Description: crystal structure of d138n mutant of drp35, a 35kda drug responsive protein from staphylococcus aureus

PDB Compounds: (E:) DrP35

SCOPe Domain Sequences for d2dsoe2:

Sequence; same for both SEQRES and ATOM records:

>d2dsoe2 b.68.6.1 (E:6-325) automated matches {Staphylococcus aureus [TaxId: 1280]}
qdlptlfysgksnsavpiiseselqtitaepwleiskkglqleglnfdrqgqlflldvfe
gnifkinpetkeikrpfvshkanpaaikihkdgrlfvcylgdfkstggifaatengdnlq
diiedlstaycindmvfdskggfyftdfrgystnplggvyyvspdfrtvtpiiqnisvan
gialstdekvlwvtettanrlhrialeddgvtiqpfgatipyyftghegpdsccidsddn
lyvamygqgrvlvfnkrgypigqilipgrdeghmlrsthpqfipgtnqliicsndiemgg
gsmlytvngfakghqsfqfq

Timeline for d2dsoe2:

• d2dsoe2 first appeared in SCOP 1.73, called d2dsoe1
  
• d2dsoe2 appears in SCOPe 2.07