SCOP 1.73: Domain d2dsoe1: 2dso E:6-324

Lineage for d2dsoe1 (2dso E:6-324)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (2 families)

5. Family b.68.6.1: SGL-like [63830] (3 proteins)

6. Protein Lactonase Drp35 [141546] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [141547] (3 PDB entries)

8. Domain d2dsoe1: 2dso E:6-324 [131693]
   automatically matched to 2DSO A:5-324
   complexed with ca, gol; mutant

Details for d2dsoe1

PDB Entry: 2dso, 2.1 Å

PDB Description: crystal structure of d138n mutant of drp35, a 35kda drug responsive protein from staphylococcus aureus

PDB Compounds: (E:) DrP35

SCOP Domain Sequences for d2dsoe1:

Sequence; same for both SEQRES and ATOM records:

>d2dsoe1 b.68.6.1 (E:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}
qdlptlfysgksnsavpiiseselqtitaepwleiskkglqleglnfdrqgqlflldvfe
gnifkinpetkeikrpfvshkanpaaikihkdgrlfvcylgdfkstggifaatengdnlq
diiedlstaycindmvfdskggfyftdfrgystnplggvyyvspdfrtvtpiiqnisvan
gialstdekvlwvtettanrlhrialeddgvtiqpfgatipyyftghegpdsccidsddn
lyvamygqgrvlvfnkrgypigqilipgrdeghmlrsthpqfipgtnqliicsndiemgg
gsmlytvngfakghqsfqf

Timeline for d2dsoe1:

• d2dsoe1 is new in SCOP 1.73
  
• d2dsoe1 appears in SCOP 1.75
  
• d2dsoe1 appears in the current release, SCOPe 2.08, called d2dsoe2