Lineage for d2dsoa1 (2dso A:5-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2808422Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) (S)
  5. 2808423Family b.68.6.1: SGL-like [63830] (4 proteins)
  6. 2808447Protein Lactonase Drp35 [141546] (1 species)
  7. 2808448Species Staphylococcus aureus [TaxId:1280] [141547] (2 PDB entries)
    Uniprot Q7A338 5-324! Uniprot Q99QV3 5-324
  8. 2808449Domain d2dsoa1: 2dso A:5-324 [131689]
    Other proteins in same PDB: d2dsoa2, d2dsob2, d2dsob3, d2dsoc2, d2dsoc3, d2dsod_, d2dsoe2, d2dsoe3, d2dsof2, d2dsof3
    complexed with ca, gol; mutant

Details for d2dsoa1

PDB Entry: 2dso (more details), 2.1 Å

PDB Description: crystal structure of d138n mutant of drp35, a 35kda drug responsive protein from staphylococcus aureus
PDB Compounds: (A:) DrP35

SCOPe Domain Sequences for d2dsoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dsoa1 b.68.6.1 (A:5-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}
qqdlptlfysgksnsavpiiseselqtitaepwleiskkglqleglnfdrqgqlflldvf
egnifkinpetkeikrpfvshkanpaaikihkdgrlfvcylgdfkstggifaatengdnl
qdiiedlstaycindmvfdskggfyftdfrgystnplggvyyvspdfrtvtpiiqnisva
ngialstdekvlwvtettanrlhrialeddgvtiqpfgatipyyftghegpdsccidsdd
nlyvamygqgrvlvfnkrgypigqilipgrdeghmlrsthpqfipgtnqliicsndiemg
ggsmlytvngfakghqsfqf

SCOPe Domain Coordinates for d2dsoa1:

Click to download the PDB-style file with coordinates for d2dsoa1.
(The format of our PDB-style files is described here.)

Timeline for d2dsoa1: