![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.11: ClpX chaperone zinc binding domain [103608] (2 proteins) |
![]() | Protein automated matches [190269] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187059] (4 PDB entries) |
![]() | Domain d2ds8b_: 2ds8 B: [131686] automated match to d1ovxa_ complexed with zn |
PDB Entry: 2ds8 (more details), 1.6 Å
SCOPe Domain Sequences for d2ds8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ds8b_ g.39.1.11 (B:) automated matches {Escherichia coli [TaxId: 562]} kllycsfcgksqhevrkliagpsvyicdecvdlcndiiree
Timeline for d2ds8b_: