SCOPe 2.08: Domain d2ds8b_: 2ds8 B:

Lineage for d2ds8b_ (2ds8 B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.11: ClpX chaperone zinc binding domain [103608] (2 proteins)

6. Protein automated matches [190269] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187059] (4 PDB entries)

8. Domain d2ds8b_: 2ds8 B: [131686]
   automated match to d1ovxa_
   complexed with zn

Details for d2ds8b_

PDB Entry: 2ds8, 1.6 Å

PDB Description: Structure of the ZBD-XB complex

PDB Compounds: (B:) ATP-dependent Clp protease ATP-binding subunit clpX

SCOPe Domain Sequences for d2ds8b_:

Sequence; same for both SEQRES and ATOM records:

>d2ds8b_ g.39.1.11 (B:) automated matches {Escherichia coli [TaxId: 562]}
kllycsfcgksqhevrkliagpsvyicdecvdlcndiiree

Timeline for d2ds8b_:

• d2ds8b_ first appeared in SCOP 1.73, called d2ds8b1
  
• d2ds8b_ appears in SCOPe 2.07