Lineage for d1ovxa_ (1ovx A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3036057Family g.39.1.11: ClpX chaperone zinc binding domain [103608] (2 proteins)
  6. 3036058Protein ClpX chaperone zinc binding domain [103609] (1 species)
  7. 3036059Species Escherichia coli [TaxId:562] [103610] (1 PDB entry)
  8. 3036060Domain d1ovxa_: 1ovx A: [93622]
    complexed with zn

Details for d1ovxa_

PDB Entry: 1ovx (more details)

PDB Description: NMR structure of the E. coli ClpX chaperone zinc binding domain dimer
PDB Compounds: (A:) ATP-dependent Clp protease ATP-binding subunit clpX

SCOPe Domain Sequences for d1ovxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovxa_ g.39.1.11 (A:) ClpX chaperone zinc binding domain {Escherichia coli [TaxId: 562]}
llycsfcgksqhevrkliagpsvyicdecvdlcndiir

SCOPe Domain Coordinates for d1ovxa_:

Click to download the PDB-style file with coordinates for d1ovxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ovxa_:

3036060
d1ovxa_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1ovxb_