Lineage for d2drwa1 (2drw A:2-363)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244822Protein D-Amino acid amidase DaaA [144038] (1 species)
  7. 2244823Species Ochrobactrum anthropi [TaxId:529] [144039] (6 PDB entries)
    Uniprot Q9LCC8 2-363
  8. 2244824Domain d2drwa1: 2drw A:2-363 [131674]
    complexed with ba

Details for d2drwa1

PDB Entry: 2drw (more details), 2.1 Å

PDB Description: The crystal structutre of D-amino acid amidase from Ochrobactrum anthropi SV3
PDB Compounds: (A:) D-amino acid amidase

SCOPe Domain Sequences for d2drwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2drwa1 e.3.1.1 (A:2-363) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]}
sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana
agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs
selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns
rs

SCOPe Domain Coordinates for d2drwa1:

Click to download the PDB-style file with coordinates for d2drwa1.
(The format of our PDB-style files is described here.)

Timeline for d2drwa1: