SCOPe 2.08: Domain d2drwa1: 2drw A:2-363

Lineage for d2drwa1 (2drw A:2-363)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein D-Amino acid amidase DaaA [144038] (1 species)

7. Species Ochrobactrum anthropi [TaxId:529] [144039] (6 PDB entries)
   Uniprot Q9LCC8 2-363

8. Domain d2drwa1: 2drw A:2-363 [131674]
   complexed with ba

Details for d2drwa1

PDB Entry: 2drw, 2.1 Å

PDB Description: The crystal structutre of D-amino acid amidase from Ochrobactrum anthropi SV3

PDB Compounds: (A:) D-amino acid amidase

SCOPe Domain Sequences for d2drwa1:

Sequence; same for both SEQRES and ATOM records:

>d2drwa1 e.3.1.1 (A:2-363) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]}
sdlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasc
tksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmis
dkswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifapl
gmkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsgana
agdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygs
selkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaikns
rs

Timeline for d2drwa1:

• d2drwa1 first appeared in SCOP 1.73
  
• d2drwa1 appears in SCOPe 2.07