Lineage for d2dmca1 (2dmc A:8-110)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 938049Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
    Pfam PF00630
  6. 938070Protein Filamin b [141025] (1 species)
  7. 938071Species Human (Homo sapiens) [TaxId:9606] [141026] (11 PDB entries)
    Uniprot O75369 1017-1134! Uniprot O75369 1130-1229! Uniprot O75369 1215-1329! Uniprot O75369 1325-1442! Uniprot O75369 1418-1518! Uniprot O75369 1611-1721! Uniprot O75369 1899-2001! Uniprot O75369 1999-2096! Uniprot O75369 2104-2192
  8. 938083Domain d2dmca1: 2dmc A:8-110 [131572]
    18th repeat

Details for d2dmca1

PDB Entry: 2dmc (more details)

PDB Description: solution structure of the 18th filamin domain from human filamin-b
PDB Compounds: (A:) Filamin-B

SCOPe Domain Sequences for d2dmca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]}
ipgspftakitddsrrcsqvklgsaadflldisetdlssltasikapsgrdepcllkrlp
nnhigisfiprevgehlvsikkngnhvanspvsimvvqseigd

SCOPe Domain Coordinates for d2dmca1:

Click to download the PDB-style file with coordinates for d2dmca1.
(The format of our PDB-style files is described here.)

Timeline for d2dmca1: