SCOP 1.73: Domain d2dmca1: 2dmc A:8-110

Lineage for d2dmca1 (2dmc A:8-110)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (4 proteins)
   Pfam PF00630

6. Protein Filamin b [141025] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141026] (9 PDB entries)

8. Domain d2dmca1: 2dmc A:8-110 [131572]
   18th repeat

Details for d2dmca1

PDB Entry: 2dmc

PDB Description: solution structure of the 18th filamin domain from human filamin-b

PDB Compounds: (A:) Filamin-B

SCOP Domain Sequences for d2dmca1:

Sequence; same for both SEQRES and ATOM records:

>d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]}
ipgspftakitddsrrcsqvklgsaadflldisetdlssltasikapsgrdepcllkrlp
nnhigisfiprevgehlvsikkngnhvanspvsimvvqseigd

Timeline for d2dmca1:

• d2dmca1 is new in SCOP 1.73
  
• d2dmca1 appears in SCOP 1.75
  
• d2dmca1 appears in the current release, SCOPe 2.08