SCOPe 2.06: Domain d2dlka2: 2dlk A:38-73

Lineage for d2dlka2 (2dlk A:38-73)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)

6. Protein Zinc finger protein 692, ZNF692 [144139] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144140] (1 PDB entry)
   Uniprot Q9BU19 328-357! Uniprot Q9BU19 358-393

8. Domain d2dlka2: 2dlk A:38-73 [131559]
   Other proteins in same PDB: d2dlka3, d2dlka4
   complexed with zn

Details for d2dlka2

PDB Entry: 2dlk

PDB Description: solution structure of the first and the second zf-c2h2 domains of zinc finger protein 692

PDB Compounds: (A:) novel protein

SCOPe Domain Sequences for d2dlka2:

Sequence; same for both SEQRES and ATOM records:

>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]}
sfscpepacgksfnfkkhlkehmklhsdtrdyicef

Timeline for d2dlka2:

• d2dlka2 first appeared in SCOP 1.73
  
• d2dlka2 appears in SCOPe 2.05
  
• d2dlka2 appears in SCOPe 2.07
  
• d2dlka2 appears in the current release, SCOPe 2.08