Class g: Small proteins [56992] (92 folds) |
Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) |
Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
Protein Zinc finger protein 692, ZNF692 [144139] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144140] (1 PDB entry) Uniprot Q9BU19 328-357! Uniprot Q9BU19 358-393 |
Domain d2dlka2: 2dlk A:38-73 [131559] complexed with zn |
PDB Entry: 2dlk (more details)
SCOPe Domain Sequences for d2dlka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} sfscpepacgksfnfkkhlkehmklhsdtrdyicef
Timeline for d2dlka2: