Lineage for d2dlka2 (2dlk A:38-73)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065096Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1065097Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families) (S)
  5. 1065098Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins)
  6. 1065313Protein Zinc finger protein 692, ZNF692 [144139] (1 species)
  7. 1065314Species Human (Homo sapiens) [TaxId:9606] [144140] (1 PDB entry)
    Uniprot Q9BU19 328-357! Uniprot Q9BU19 358-393
  8. 1065316Domain d2dlka2: 2dlk A:38-73 [131559]
    complexed with zn

Details for d2dlka2

PDB Entry: 2dlk (more details)

PDB Description: solution structure of the first and the second zf-c2h2 domains of zinc finger protein 692
PDB Compounds: (A:) novel protein

SCOPe Domain Sequences for d2dlka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]}
sfscpepacgksfnfkkhlkehmklhsdtrdyicef

SCOPe Domain Coordinates for d2dlka2:

Click to download the PDB-style file with coordinates for d2dlka2.
(The format of our PDB-style files is described here.)

Timeline for d2dlka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dlka1