PDB entry 2dlk

View 2dlk on RCSB PDB site
Description: Solution structure of the first and the second zf-C2H2 domains of zinc finger protein 692
Class: DNA binding protein
Keywords: zf-C2H2 domain, zinc finger protein 692, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2006-04-20, released 2006-10-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: novel protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ZNF692
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BU19 (7-72)
      • cloning artifact (0-6)
      • cloning artifact (73-78)
    Domains in SCOPe 2.01: d2dlka1, d2dlka2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dlkA (A:)
    gssgssgmpcdfpgcgrifsnrqylnhhkkyqhihqksfscpepacgksfnfkkhlkehm
    klhsdtrdyicefsgpssg