SCOPe 2.02: Domain d2dj7a2: 2dj7 A:8-43

Lineage for d2dj7a2 (2dj7 A:8-43)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.3: LIM domain [57736] (18 proteins)
   duplication: contains two (sub)domains of this fold

6. Protein Actin-binding LIM protein 3, abLIM-3 [144179] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144180] (1 PDB entry)
   Uniprot O94929 141-176! Uniprot O94929 177-207

8. Domain d2dj7a2: 2dj7 A:8-43 [131539]
   complexed with zn

Details for d2dj7a2

PDB Entry: 2dj7

PDB Description: solution structure of 3rd lim domain of actin-binding lim protein 3

PDB Compounds: (A:) Actin-binding LIM protein 3

SCOPe Domain Sequences for d2dj7a2:

Sequence; same for both SEQRES and ATOM records:

>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]}
kpikirgpshcagckeeikhgqsllaldkqwhvscf

Timeline for d2dj7a2:

• d2dj7a2 first appeared in SCOP 1.73
  
• d2dj7a2 appears in SCOPe 2.01
  
• d2dj7a2 appears in SCOPe 2.03
  
• d2dj7a2 appears in the current release, SCOPe 2.08