![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (4 families) ![]() |
![]() | Family b.34.9.1: Tudor domain [63749] (7 proteins) Pfam PF00567 |
![]() | Protein Lamin-b receptor [141209] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141210] (1 PDB entry) Uniprot Q14739 1-55 |
![]() | Domain d2diga1: 2dig A:8-62 [131529] |
PDB Entry: 2dig (more details)
SCOP Domain Sequences for d2diga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2diga1 b.34.9.1 (A:8-62) Lamin-b receptor {Human (Homo sapiens) [TaxId: 9606]} mpsrkfadgevvrgrwpgsslyyeveilshdstsqlytvkykdgtelelkendik
Timeline for d2diga1: