Class a: All alpha proteins [46456] (286 folds) |
Fold a.269: FtsH protease domain-like [140989] (1 superfamily) array of 6 helices and a 2-stranded beta-ribbon |
Superfamily a.269.1: FtsH protease domain-like [140990] (1 family) contains zincin-like (55486) metal-binding motif HExxH, embedded into a topologically different fold automatically mapped to Pfam PF01434 |
Family a.269.1.1: FtsH protease domain-like [140991] (2 proteins) Pfam PF01434; Peptidase family M41 |
Protein Cell division protein FtsH, C-terminal domain [140992] (2 species) |
Species Aquifex aeolicus [TaxId:63363] [140993] (1 PDB entry) Uniprot O67077 406-607 |
Domain d2di4b_: 2di4 B: [131523] automated match to d2di4a1 complexed with hg |
PDB Entry: 2di4 (more details), 2.79 Å
SCOPe Domain Sequences for d2di4b_:
Sequence, based on SEQRES records: (download)
>d2di4b_ a.269.1.1 (B:) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} ispkekekiaiheaghalmglvsddddkvhkisiiprgmalgvtqqlpiedkhiydkkdl ynkilvllggraaeevffgkdgittgaendlqratdlayrmvsmwgmsdkvgpiairrva npflggmttavdtspdllreideevkriiteqyekakaiveeykeplkavvkklleketi tceefvevfklygielkdkck
>d2di4b_ a.269.1.1 (B:) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} ispkekekiaiheaghalmglvsddddkvhkisiiphiydkkdlynkilvllggraaeev ffgkdgittgaendlqratdlayrmvsmwgmsdkvgpiairrtavdtspdllreideevk riiteqyekakaiveeykeplkavvkklleketitceefvevfklygielkdkck
Timeline for d2di4b_: