SCOPe 2.08: Domain d2di4b_: 2di4 B:

Lineage for d2di4b_ (2di4 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.269: FtsH protease domain-like [140989] (1 superfamily)
   array of 6 helices and a 2-stranded beta-ribbon

4. Superfamily a.269.1: FtsH protease domain-like [140990] (1 family)
   contains zincin-like (55486) metal-binding motif HExxH, embedded into a topologically different fold
   automatically mapped to Pfam PF01434

5. Family a.269.1.1: FtsH protease domain-like [140991] (2 proteins)
   Pfam PF01434; Peptidase family M41

6. Protein Cell division protein FtsH, C-terminal domain [140992] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [140993] (1 PDB entry)
   Uniprot O67077 406-607

8. Domain d2di4b_: 2di4 B: [131523]
   automated match to d2di4a1
   complexed with hg

Details for d2di4b_

PDB Entry: 2di4, 2.79 Å

PDB Description: Crystal structure of the FtsH protease domain

PDB Compounds: (B:) Cell division protein ftsH homolog

SCOPe Domain Sequences for d2di4b_:

Sequence, based on SEQRES records:

>d2di4b_ a.269.1.1 (B:) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
ispkekekiaiheaghalmglvsddddkvhkisiiprgmalgvtqqlpiedkhiydkkdl
ynkilvllggraaeevffgkdgittgaendlqratdlayrmvsmwgmsdkvgpiairrva
npflggmttavdtspdllreideevkriiteqyekakaiveeykeplkavvkklleketi
tceefvevfklygielkdkck

Sequence, based on observed residues (ATOM records):

>d2di4b_ a.269.1.1 (B:) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
ispkekekiaiheaghalmglvsddddkvhkisiiphiydkkdlynkilvllggraaeev
ffgkdgittgaendlqratdlayrmvsmwgmsdkvgpiairrtavdtspdllreideevk
riiteqyekakaiveeykeplkavvkklleketitceefvevfklygielkdkck

Timeline for d2di4b_:

• d2di4b_ first appeared in SCOP 1.73, called d2di4b1
  
• d2di4b_ appears in SCOPe 2.07