SCOPe 2.08: Domain d2dfha_: 2dfh A:

Lineage for d2dfha_ (2dfh A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein automated matches [190266] (7 species)
   not a true protein

7. Species Thermococcus kodakarensis [TaxId:69014] [187055] (3 PDB entries)

8. Domain d2dfha_: 2dfh A: [131472]
   automated match to d1io2a_

Details for d2dfha_

PDB Entry: 2dfh, 2.27 Å

PDB Description: Crystal structure of Tk-RNase HII(1-212)-C

PDB Compounds: (A:) ribonuclease hii

SCOPe Domain Sequences for d2dfha_:

Sequence; same for both SEQRES and ATOM records:

>d2dfha_ c.55.3.1 (A:) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
mkiagideagrgpvigpmviaavvvdenslpkleelkvrdskkltpkrreklfneilgvl
ddyvilelppdvigsregtlnefevenfakalnslkvkpdviyadaadvdeerfarelge
rlnfeaevvakhkaddifpvvsaasilakvtrdraveklkeeygeigsgypsdprtrafl
enyyrehgefppivrkgwktlkkiaekvesektqdminkst

Timeline for d2dfha_:

• d2dfha_ first appeared in SCOP 1.73, called d2dfha1
  
• d2dfha_ appears in SCOPe 2.07