SCOP 1.73: Domain d2dfha1: 2dfh A:1-212

Lineage for d2dfha1 (2dfh A:1-212)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (12 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (4 proteins)

6. Protein Class II ribonuclease H (RNase HII) [53103] (5 species)

7. Species Archaeon Thermococcus kodakaraensis [TaxId:311400] [64094] (2 PDB entries)

8. Domain d2dfha1: 2dfh A:1-212 [131472]
   automatically matched to d1io2a_
   mutant

Details for d2dfha1

PDB Entry: 2dfh, 2.27 Å

PDB Description: Crystal structure of Tk-RNase HII(1-212)-C

PDB Compounds: (A:) ribonuclease hii

SCOP Domain Sequences for d2dfha1:

Sequence; same for both SEQRES and ATOM records:

>d2dfha1 c.55.3.1 (A:1-212) Class II ribonuclease H (RNase HII) {Archaeon Thermococcus kodakaraensis [TaxId: 311400]}
mkiagideagrgpvigpmviaavvvdenslpkleelkvrdskkltpkrreklfneilgvl
ddyvilelppdvigsregtlnefevenfakalnslkvkpdviyadaadvdeerfarelge
rlnfeaevvakhkaddifpvvsaasilakvtrdraveklkeeygeigsgypsdprtrafl
enyyrehgefppivrkgwktlkkiaekvesek

Timeline for d2dfha1:

• d2dfha1 is new in SCOP 1.73
  
• d2dfha1 appears in SCOP 1.75
  
• d2dfha1 appears in the current release, SCOPe 2.08, called d2dfha_