SCOP 1.73: Domain d2dfba1: 2dfb A:1-190

Lineage for d2dfba1 (2dfb A:1-190)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (16 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Trichoderma reesei, xynII [TaxId:51453] [49985] (10 PDB entries)

8. Domain d2dfba1: 2dfb A:1-190 [131470]
   automatically matched to d1enxa_
   complexed with iod, so4

Details for d2dfba1

PDB Entry: 2dfb, 1.11 Å

PDB Description: xylanase ii from tricoderma reesei at 100k

PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOP Domain Sequences for d2dfba1:

Sequence; same for both SEQRES and ATOM records:

>d2dfba1 b.29.1.11 (A:1-190) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

Timeline for d2dfba1:

• d2dfba1 is new in SCOP 1.73
  
• d2dfba1 appears in SCOP 1.75
  
• d2dfba1 appears in the current release, SCOPe 2.08, called d2dfba_