Lineage for d2dfba_ (2dfb A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780100Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2780238Species Trichoderma reesei, xynII [TaxId:51453] [49985] (16 PDB entries)
  8. 2780239Domain d2dfba_: 2dfb A: [131470]
    automated match to d1enxa_
    complexed with iod, so4

Details for d2dfba_

PDB Entry: 2dfb (more details), 1.11 Å

PDB Description: xylanase ii from tricoderma reesei at 100k
PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d2dfba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dfba_ b.29.1.11 (A:) Xylanase II {Trichoderma reesei, xynII [TaxId: 51453]}
etiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvi
nfsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrt
qrvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyf
ssgsasitvs

SCOPe Domain Coordinates for d2dfba_:

Click to download the PDB-style file with coordinates for d2dfba_.
(The format of our PDB-style files is described here.)

Timeline for d2dfba_: